Axial Commons Image Treasury
Grabado de interior con mujeres y niñas en trajes del siglo XVIII alrededor de una mesa, y un niño sostenido por una mujer junto a una pared con paneles.

Entretenimientos matutinos de la Princesa Real y sus hermanas

Un grabado de interior muestra a una mujer de vestido blanco y tocado de plumas sentada a una mesa con tres niñas, y a una mujer de pie que sostiene a un niño. Líneas finas de sombreado modelan los vestidos drapeados y el candelabro de pared, y una leyenda impresa en el borde inferior indica la fecha 1777.

Artista
William Blake
Fecha
1782
Técnica
Fuente
Wikimedia Commons / Wikidata
Tamaño
3798 × 3233 px
Descargar en tamaño completo
Dominio público · William Blake died 1827 and the work dates by 1782; public domain in the US and life+70 countries.
Derechos verificados 2026-11-05 · nivel B · según la fuente: CC0

Crédito (se agradece, no es obligatorio en obras de dominio público): William Blake, via Wikimedia Commons (CC0)

William Blake18th centuryengravingprintetchingprintmakinggenre scenechildrenfeathered headdresstable scenefamily interiorwilliam blake

Más de William Blake

The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."