Axial Commons Image Treasury
Grabado en madera con borde negro: diablos con cuernos y brujas con sombrero tomadas de la mano en un círculo, bailando.

Brujas y diablos bailando en círculo, grabado en madera, 1720

Un grabado en madera en blanco y negro, enmarcado por un borde recto, muestra cinco figuras de diablos con cuernos alternadas con brujas con túnicas y sombreros que se dan la mano en un círculo. Líneas finas sombrean el suelo y las ropas. La escena es animada y llena todo el encuadre con los bailarines.

Artista
Desconocido
Fecha
1720
Técnica
Woodcuts
Fuente
Wellcome Collection
Tamaño
4000 × 3453 px
Descargar en tamaño completo
Dominio público · Wellcome Collection marks it Public Domain Mark; made by 1720.
Derechos verificados 2026-11-05 · nivel A · según la fuente: Public Domain Mark (Wellcome Collection)

Crédito (se agradece, no es obligatorio en obras de dominio público): Wellcome Collection

La vida de CristoDioses y epopeyas de la India18th century1720s1720engravingwoodcutearly modern printdevilwitchcraftwitchesdemonologyhorned devildancingfolk magicblack and white

Más de La vida de Cristo

The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving by H. Goudt, 1613, after A. Elsheimer, 1609.The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving bSaint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. Strange after G. Reni.Saint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. StranHead of ChristHead of ChristInnocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; Justice looks down from above. Etching by C. Murer after himself, c. 1600-1614.Innocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; De Heilige FamilieDe Heilige FamilieThe mocking of Christ. Etching by A. van Dyck.The mocking of Christ. Etching by A. van Dyck.