Axial Commons Image Treasury
Xilogravura com borda preta: diabos com chifres e bruxas de chapéu de mãos dadas em círculo, dançando.

Bruxas e diabos dançando em círculo, xilogravura, 1720

Uma xilogravura em preto e branco, emoldurada por uma borda reta, mostra cinco figuras de diabos com chifres alternadas com bruxas de túnicas e chapéus que dão as mãos formando um círculo. Linhas finas sombreiam o chão e as roupas. A cena é animada e preenche todo o quadro com os dançarinos.

Artista
Desconhecido
Data
1720
Técnica
Woodcuts
Fonte
Wellcome Collection
Tamanho
4000 × 3453 px
Baixar em tamanho original
Domínio público · Wellcome Collection marks it Public Domain Mark; made by 1720.
Direitos verificados 2026-11-05 · nível A · conforme a fonte: Public Domain Mark (Wellcome Collection)

Crédito (bem-vindo, não obrigatório em obras de domínio público): Wellcome Collection

A vida de CristoDeuses e epopeias da Índia18th century1720s1720engravingwoodcutearly modern printdevilwitchcraftwitchesdemonologyhorned devildancingfolk magicblack and white

Mais de A vida de Cristo

The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving by H. Goudt, 1613, after A. Elsheimer, 1609.The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving bSaint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. Strange after G. Reni.Saint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. StranHead of ChristHead of ChristInnocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; Justice looks down from above. Etching by C. Murer after himself, c. 1600-1614.Innocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; De Heilige FamilieDe Heilige FamilieThe mocking of Christ. Etching by A. van Dyck.The mocking of Christ. Etching by A. van Dyck.