Axial Commons Image Treasury
Estampa grabada de un alquimista con túnica junto a un horno de ladrillo y fuelles, con estantes de frascos y marco decorativo.

El mundo en el juego de cartas: alquimista junto a un horno

Una estampa grabada con aspecto de carta de juego, con marco de cartucho y el numeral IV arriba, muestra a un alquimista con túnica de pie ante un horno de ladrillo, con fuelles y humo ascendente. Detrás hay estantes con frascos rotulados, y un pie impreso dice Die Luftgebäude, La Chimère.

Artista
anoniem
Fecha
1750-1770
Técnica
Fuente
Rijksmuseum
Tamaño
1984 × 3244 px
Descargar en tamaño completo
Dominio público · Rijksmuseum marks it Public Domain Mark; made by 1770.
Derechos verificados 2026-11-05 · nivel A · según la fuente: Public Domain Mark (Rijksmuseum, image license https://creativecommons.org/publicdomain/mark/1.0/)

Crédito (se agradece, no es obligatorio en obras de dominio público): Rijksmuseum, Amsterdam

Alquimia y saber oculto18th centuryengravingprintmakingalchemydecorative printfurnacealchemistlaboratorybellows

Más de Alquimia y saber oculto

Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Cupido plast in een potCupido plast in een pot"Fire Cross" Engine Emblem"Fire Cross" Engine EmblemCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMBCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMB