Axial Commons Image Treasury
Gravura de um alquimista de túnica ao lado de um forno de tijolos e foles, com prateleiras de frascos e moldura decorativa.

O mundo no jogo de cartas: alquimista junto a um forno

Uma gravura com aspecto de carta de baralho, com moldura de cartucho e o numeral IV no alto, mostra um alquimista de túnica em pé diante de um forno de tijolos, com foles e fumaça ascendente. Atrás há prateleiras com frascos rotulados, e uma legenda impressa diz Die Luftgebäude, La Chimère.

Artista
anoniem
Data
1750-1770
Técnica
Fonte
Rijksmuseum
Tamanho
1984 × 3244 px
Baixar em tamanho original
Domínio público · Rijksmuseum marks it Public Domain Mark; made by 1770.
Direitos verificados 2026-11-05 · nível A · conforme a fonte: Public Domain Mark (Rijksmuseum, image license https://creativecommons.org/publicdomain/mark/1.0/)

Crédito (bem-vindo, não obrigatório em obras de domínio público): Rijksmuseum, Amsterdam

Alquimia e saber oculto18th centuryengravingprintmakingalchemydecorative printfurnacealchemistlaboratorybellows

Mais de Alquimia e saber oculto

Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Cupido plast in een potCupido plast in een pot"Fire Cross" Engine Emblem"Fire Cross" Engine EmblemCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMBCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMB